PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT06866
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 240aa    MW: 27277.5 Da    PI: 6.9559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT06866genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed+ll+ +v+q G g+W+++a+  g++R++k+c++rw +yl
         EMT06866 15 KGPWTAQEDKLLLGYVRQQGDGRWNSVAKLTGLKRSGKSCRLRWVNYL 62
                     79********************************************97 PP

2Myb_DNA-binding51.32.6e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
         EMT06866  68 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 112
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.9111062IPR017930Myb domain
SuperFamilySSF466893.74E-2913109IPR009057Homeodomain-like
SMARTSM007172.4E-131464IPR001005SANT/Myb domain
PfamPF002496.4E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-231669IPR009057Homeodomain-like
CDDcd001671.01E-91762No hitNo description
PROSITE profilePS5129424.93363117IPR017930Myb domain
SMARTSM007174.5E-1567115IPR001005SANT/Myb domain
PfamPF002494.7E-1468112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2470115IPR009057Homeodomain-like
CDDcd001676.19E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MEQFGWGREE GGWRKGPWTA QEDKLLLGYV RQQGDGRWNS VAKLTGLKRS GKSCRLRWVN  60
YLRPDLKRGK ITPQEESVIL ELHALWGNRW STIARSLPGR TDNEIKNYWR THFKKGKPSS  120
KNIERARARF LKQRREIMQG HHEHQRDDDD DLAMMRDMAD MDEFLQYDHH PMSMSAYFLL  180
DGGDGAASDA GSSGEITTCG ATWGSLWNLD DVDVVDDVGG GGACGWGSFA LLQDHGLAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25151157106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-143AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-143AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624171.11e-108PREDICTED: transcription factor MYB57
TrEMBLM8AQQ71e-178M8AQQ7_AEGTA; Transcription factor MYB48
STRINGMLOC_6786.11e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-65myb domain protein 79